PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00128g00742.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family MYB_related
Protein Properties Length: 161aa    MW: 18876.2 Da    PI: 4.8179
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00128g00742.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.61.2e-121457146
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
           Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                              rg+WT eEd +l + +   G  +W+++++  g  Rt++++k++w++
  Peaxi162Scf00128g00742.1 14 RGPWTIEEDHKLMNFILNNGIQCWRLVPKLAG--RTDNEIKNHWNT 57
                              89*****************************8..**********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.1E-18564IPR009057Homeodomain-like
SuperFamilySSF466893.23E-14865IPR009057Homeodomain-like
PROSITE profilePS5129420.553963IPR017930Myb domain
SMARTSM007174.8E-61361IPR001005SANT/Myb domain
PfamPF002492.5E-101457IPR001005SANT/Myb domain
CDDcd001674.67E-61657No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 161 aa     Download sequence    Send to blast
MGRQPCCDKI GLKRGPWTIE EDHKLMNFIL NNGIQCWRLV PKLAGRTDNE IKNHWNTRIK  60
KKLKLLGLDP LTHKPIEQFD HLKNDDIEQQ DSSEKEEKEK LELLEKNLPN SLDYTQEQEI  120
QNSTSSSSLD DMNNFQNSES LETFSKEMFN SGLEDPFQNW I
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754441e-53HG975444.1 Solanum pennellii chromosome ch05, complete genome.
GenBankHG9755171e-53HG975517.1 Solanum lycopersicum chromosome ch05, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009779623.16e-69PREDICTED: myb-related protein 315
RefseqXP_016477155.16e-69PREDICTED: myb-related protein 315-like
SwissprotQ50EX61e-30ODO1_PETHY; Protein ODORANT1
TrEMBLK4BYE94e-54K4BYE9_SOLLC; Uncharacterized protein
TrEMBLM1AVE34e-54M1AVE3_SOLTU; Uncharacterized protein
STRINGSolyc05g014290.2.11e-53(Solanum lycopersicum)
STRINGPGSC0003DMT4000312501e-53(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14340.12e-33myb domain protein 40